Pramlintide
Research profile · How we handle evidence
Pramlintide (brand name Symlin) is an FDA-approved synthetic analog of human amylin, a hormone co-secreted with insulin by pancreatic beta cells. It slows gastric emptying, suppresses glucagon secretion, and promotes satiety, and is approved as an adjunct to mealtime insulin in type 1 and type 2 diabetes.
Evidence Score
High confidence
Category
Therapeutic area
Standard Dose
Before meals
Half-life
Plasma elimination
Route
Subcutaneous
Safety Tier
Well characterized
Overview
Pramlintide mimics amylin, a natural post-meal hormone that helps you feel full and keeps blood sugar from spiking too fast after eating. It's an approved diabetes medication, and its appetite-suppressing effect is also why it's discussed in fat-loss and GLP-1-combination contexts.
Mechanism of Action
Pramlintide mimics amylin, a natural post-meal hormone that helps you feel full and keeps blood sugar from spiking too fast after eating. It's an approved diabetes medication, and its appetite-suppressing effect is also why it's discussed in fat-loss and GLP-1-combination contexts.
Benefits
- Slows gastric emptying, extending post-meal fullness
- Suppresses inappropriate post-meal glucagon secretion
- Approved adjunct for post-meal glucose control in insulin-treated diabetes
- Associated with modest weight reduction in clinical use
Side Effects
- Nausea, especially when starting or increasing dose
- Risk of severe hypoglycemia when combined with insulin
- Injection-site reactions
- Reduced appetite/vomiting in some patients
Contraindications
- Hypoglycemia unawareness
- Gastroparesis
- Concurrent use with drugs that slow GI motility
- Pediatric use not established
Structure & Sequence
Verified structure
Pramlintide
Sequence illustration backed by PubChem match.
- Amino Acid Sequence
- KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (37aa, Pro25/28/29 vs native amylin, Cys2-Cys7 disulfide bridge)
- Cyclization
- Disulfide-bridged
- Molecular Weight
- 3,949.4 Da
- Chemical Formula
- C171H267N51O53S2
- CAS Number
- 196078-30-5
- InChIKey
- TZIRZGBAFTZREM-MKAGXXMWSA-N
Stack & Route Context
Stacks with
No entries listed.
Administration
Subcutaneous
Research Status
FDA-approved since 2005 as Symlin for insulin-treated diabetes. Extensively studied in humans, including long-term clinical safety data; off-label fat-loss interest is more recent and less studied than its approved glycemic indication.
Approval Status
Approved
Sports Legal
Permitted
References
- 1View source
SYMLIN (pramlintide acetate) injection - FDA prescribing information
2007
- 2View source
Amino acid sequence of pramlintide
2013
This profile summarizes research literature for education only. It is not medical advice, and it does not diagnose, treat, or recommend a dose. Consult a qualified professional before changing a protocol.