IGF-1 LR3
Research profile · How we handle evidence
IGF-1 LR3 is a modified form of insulin-like growth factor 1 (IGF-1) designed to last longer in the body. It shows up in some bodybuilding and research contexts, but it is not an approved performance drug.
Evidence Score
Preliminary signal
Category
Therapeutic area
Standard Dose
Daily
Half-life
Plasma elimination
Route
Subcutaneous
Safety Tier
Limited data
Overview
IGF-1 LR3 is IGF-1 with specific amino-acid changes intended to increase time in circulation. In mechanistic and animal work, IGF-1 signaling is tied to growth and repair pathways, which is why people talk about it for training recovery. It can also shift blood-sugar dynamics, so dosing and timing are not “set and forget.” Treat it as investigational, not a casual supplement.
Mechanism of Action
IGF-1 LR3 is IGF-1 with specific amino-acid changes intended to increase time in circulation. In mechanistic and animal work, IGF-1 signaling is tied to growth and repair pathways, which is why people talk about it for training recovery. It can also shift blood-sugar dynamics, so dosing and timing are not “set and forget.” Treat it as investigational, not a casual supplement.
pH & Mixing
Peptides reconstituted at very different pH levels can destabilize when combined in the same syringe, which lowers how much of the peptide your body actually absorbs. If you're unsure whether two peptides are close enough in pH, reconstitute and inject them separately.
A dedicated compatibility check between two specific peptides is coming to the Compare tool. This section covers this peptide's pH only.
Benefits
- Longer-lasting IGF-1 related signaling compared with native IGF-1
- Research interest in muscle and tissue growth signaling
- Some mechanistic links to repair and recovery pathways
Side Effects
- Lower blood sugar risk in some contexts, especially with missed meals
- Possible fluid retention or pressure-related discomfort with incorrect or excessive use
- Joint or muscle aches are reported by some users
- Theoretical risk of unwanted growth signaling if exposure is prolonged or high
Contraindications
- Pregnant or breastfeeding women
- Individuals under 18 years old
- Those with known allergies to peptide components
- Active cancer
- Uncontrolled diabetes or unstable blood sugar
Structure & Sequence
Verified structure
IGF-1 LR3
Illustration uses the catalog amino acid sequence because no exact external registry match was confirmed.
- Amino Acid Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (83aa)
- Molecular Weight
- 9,117.5 Da
- Chemical Formula
- C400H625N111O115S9
- CAS Number
- 140850-27-9
- Reconstituted pH
- 10.1
Stack & Route Context
Stacks with
- HGH
- Testosterone
Administration
Subcutaneous
Research Status
Research chemical (investigational). Used in some bodybuilding contexts.
Approval Status
Research
Sports Legal
Restricted
References
No references listed.
This profile summarizes research literature for education only. It is not medical advice, and it does not diagnose, treat, or recommend a dose. Consult a qualified professional before changing a protocol.