IGF-1 DES
Research profile · How we handle evidence
Des(1-3) IGF-1 (often written IGF-1 DES) is a truncated IGF-1 analog studied for altered receptor interactions.
Evidence Score
Preclinical signal
Category
Therapeutic area
Standard Dose
Multiple times daily
Half-life
Plasma elimination
Route
Subcutaneous or Intramuscular
Safety Tier
Limited data
Overview
IGF-1 DES is a shortened form of IGF-1 where the first three amino acids are removed. In biochemical terms, that change can alter how the molecule interacts with IGF receptors and binding proteins, which is part of why researchers study this fragment. The practical side is that IGF-axis peptides can affect glucose/insulin-related pathways, so safety depends on dose, monitoring, and individual physiology. If you are researching these compounds, treat the topic as a high-stakes endocrine research area, not a casual supplement lane.
Mechanism of Action
IGF-1 DES is a shortened form of IGF-1 where the first three amino acids are removed. In biochemical terms, that change can alter how the molecule interacts with IGF receptors and binding proteins, which is part of why researchers study this fragment. The practical side is that IGF-axis peptides can affect glucose/insulin-related pathways, so safety depends on dose, monitoring, and individual physiology. If you are researching these compounds, treat the topic as a high-stakes endocrine research area, not a casual supplement lane.
pH & Mixing
Peptides reconstituted at very different pH levels can destabilize when combined in the same syringe, which lowers how much of the peptide your body actually absorbs. If you're unsure whether two peptides are close enough in pH, reconstitute and inject them separately.
A dedicated compatibility check between two specific peptides is coming to the Compare tool. This section covers this peptide's pH only.
Benefits
- Enhanced muscle growth
- Faster action than IGF-1
- Localized effects
- Increased protein synthesis
Side Effects
- Hypoglycemia
- Injection site reactions
- Potential organ growth
Contraindications
- Cancer
- Pregnancy
- Minors
Structure & Sequence
Verified structure
IGF-1 DES
Illustration uses the catalog amino acid sequence because no exact external registry match was confirmed.
- Amino Acid Sequence
- TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA
- Molecular Weight
- 7,371.5 Da
- Chemical Formula
- C319H501N91O96S7
- CAS Number
- N/A
- Reconstituted pH
- 9.7
Stack & Route Context
Stacks with
- HGH
- Testosterone
Administration
Subcutaneous or Intramuscular
Research Status
Research chemical
Approval Status
Preclinical
Sports Legal
Restricted
References
No references listed.
This profile summarizes research literature for education only. It is not medical advice, and it does not diagnose, treat, or recommend a dose. Consult a qualified professional before changing a protocol.