Follistatin 344
Research profile · How we handle evidence
A regulatory protein in the activin/inhibin signaling system that can bind and neutralize several signaling molecules, including myostatin and activins.
Evidence Score
Preclinical signal
Category
Therapeutic area
Standard Dose
Daily for 10-30 days
Half-life
Plasma elimination
Route
Subcutaneous
Safety Tier
Limited data
Overview
Follistatin 344 is a form of follistatin used in research because it can bind members of the TGF-β family, including myostatin and activins. In muscle biology, myostatin is often described as a "brake" on growth, so follistatin can shift signaling away from growth inhibition. That said, the downstream effects depend on the full signaling network in a given tissue, and most of the strong "muscle growth" narratives come from preclinical models. In other words: it is biologically interesting and worth studying, but it is not a proven, general-purpose performance intervention for humans.
Mechanism of Action
Follistatin 344 is a form of follistatin used in research because it can bind members of the TGF-β family, including myostatin and activins. In muscle biology, myostatin is often described as a "brake" on growth, so follistatin can shift signaling away from growth inhibition. That said, the downstream effects depend on the full signaling network in a given tissue, and most of the strong "muscle growth" narratives come from preclinical models. In other words: it is biologically interesting and worth studying, but it is not a proven, general-purpose performance intervention for humans.
pH & Mixing
Peptides reconstituted at very different pH levels can destabilize when combined in the same syringe, which lowers how much of the peptide your body actually absorbs. If you're unsure whether two peptides are close enough in pH, reconstitute and inject them separately.
A dedicated compatibility check between two specific peptides is coming to the Compare tool. This section covers this peptide's pH only.
Benefits
- Blocks muscle-limiting myostatin
- Enhanced muscle growth
- Increased strength
- May improve body composition
Side Effects
- Limited human data
- Potential joint issues
- Unknown long-term effects
Contraindications
- Pregnant or breastfeeding women
- Individuals under 18 years old
- Those with known allergies to peptide components
- Active cancer
- Uncontrolled diabetes
Structure & Sequence
Verified structure
Follistatin 344
Illustration uses the catalog amino acid sequence because no exact external registry match was confirmed.
- Amino Acid Sequence
- GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN
- Molecular Weight
- ~34,760 Da
- Chemical Formula
- C1513H2314N422O469S35
- Reconstituted pH
- ~7.4
Stack & Route Context
Stacks with
- Testosterone
- Anavar
Administration
Subcutaneous
Research Status
Research peptide. Gene therapy in development.
Approval Status
Preclinical
Sports Legal
Permitted
References
No references listed.
This profile summarizes research literature for education only. It is not medical advice, and it does not diagnose, treat, or recommend a dose. Consult a qualified professional before changing a protocol.